PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g23300.1.p
Common NameBRADI_5g23300, LOC104585443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 954aa    MW: 103608 Da    PI: 6.1964
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g23300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28569620152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isl++l+kyFs+++kdAAk+Lgvc+T+LKriCR +GI+RWP+Rki+++
  Bradi5g23300.1.p 569 AEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRAHGISRWPSRKINKV 620
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557813.77E-5210289IPR029016GAF domain-like
PROSITE profilePS5151916.893559640IPR003035RWP-RK domain
PfamPF020428.0E-26572620IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.5E-22850932No hitNo description
SuperFamilySSF542774.25E-23850936No hitNo description
PROSITE profilePS5174524.31853935IPR000270PB1 domain
SMARTSM006664.5E-21853935IPR000270PB1 domain
PfamPF005643.6E-18854934IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 954 aa     Download sequence    Send to blast
MDVPAPSSRA GCNRNMGSPV TEPSDDPYGV PATMNFDGYL ELCSPSLADQ LYSLVNDPSA  60
HQMFAMWSSL GSSPRASGMS EDMPLGAYAG VSEAVAAAPP QKNDLVASEN PAETGRVARS  120
SGEPGADSDP GQGRTSLVPR PVGGNFLADR MLMALSFFRE SLGDGVLAQV WMPVEQEGHA  180
VLSTSDQPFL LDQSLAGYRE VSRNFVFSAK EETGLHPGLP GRVFISGVPE WTSNVLYYSK  240
PEYLRMEYAL HHEVRGSLAM PIYDPSKGSC CAVLELITKR EKPDFNAEMD NVRQALQAVN  300
LKTTKDCSNQ KFYTENQKAA FTEILDVLRA ICHAHMLPLA LTWVPMSNGI DGAYVVGRDG  360
GLGSQSGKEI LCVHESACYV NDAKMKGFFH ACAESPLEKG QGIAGRALKS NLPFFSPNIR  420
EYNIKDYPLA HHARKFGLHA AVAIRLRSTY TGNDDYILEF FLPINCKGSE EQQMLLNNLS  480
STMQRICKSL RTVAESEVDK VDARNAVLYK TTSESVSPTG HSESSSHCDK PITEASFQDL  540
SLVDKQGYME PEQVQSSSMR LAEKKRSTAE KNISLDVLRK YFSGSLKDAA KSLGVCPTTL  600
KRICRAHGIS RWPSRKINKV NRSLKKIQTV INSVHGVDSS LQYDPGTGSL VPAASLPEKR  660
PASSTDALPA LSSGKTVEQK SVPKSEQAYS SPDGWQSESY QVQLSDAEKG EGGEFHMQTS  720
NHSDIGNHTS YGANVTPHVS PEGTQGQSYP VGTVSAFHPK ETGCVSPFVS ARPTAENTGD  780
QIVGRNSPSL QQADIDMVDD AFQKTNMVDD HEAREHTHPS TSGMTDSSSG SASSHPTFKK  840
EPGHALKGKS GPTLTVKATY NGDTVRFKFL PSQGWYQLLE EIAKRFKLST GTFQLKYKDD  900
EDEWVILAND SDLQECVEVM DSMGSCNVKL QVRDLPCLIS SSSGSSTCLR LPT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240492.10.0PREDICTED: protein NLP2-like
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLI1J2C50.0I1J2C5_BRADI; Uncharacterized protein
STRINGBRADI5G23300.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein